PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 287aa    MW: 32610.5 Da    PI: 6.6876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35251.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.11.9e-131459146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ v+++G+++W++I ++  ++Rt+k+c++rw +
       KFK35251.1 14 KGPWKAEEDEVLLNHVNRYGPRDWSSIRSKGLLHRTGKSCRLRWVN 59
                     79*************************888779***********87 PP

2Myb_DNA-binding43.38.6e-1470109344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE+ + +++  ++G++ W++Ia +++ gRt++++k++w
       KFK35251.1  70 KFSAEEERIVIELQSEFGNK-WARIATYLP-GRTDNDVKNFW 109
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-21862IPR009057Homeodomain-like
PROSITE profilePS5129421.283965IPR017930Myb domain
SuperFamilySSF466891.22E-2812109IPR009057Homeodomain-like
SMARTSM007176.7E-121363IPR001005SANT/Myb domain
CDDcd001674.02E-111661No hitNo description
PfamPF139211.6E-111767No hitNo description
Gene3DG3DSA:1.10.10.601.9E-1863115IPR009057Homeodomain-like
PROSITE profilePS5129418.73566117IPR017930Myb domain
SMARTSM007175.3E-1367115IPR001005SANT/Myb domain
PfamPF002491.5E-1270109IPR001005SANT/Myb domain
CDDcd001671.60E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MKKTESTKKE EIKKGPWKAE EDEVLLNHVN RYGPRDWSSI RSKGLLHRTG KSCRLRWVNK  60
LRPNLKNGCK FSAEEERIVI ELQSEFGNKW ARIATYLPGR TDNDVKNFWS SRQKRLARIL  120
HNSSDASSSS NLNPKSSSSS SQNKGKNVKP IQSFNPNSQG FGLLEEEVIT ATETVDESLR  180
LPELGVKLEH QPFAFGTDLV SEVQIDANDQ QGMIPFSPES RELLARLDDP YFYDILGPAD  240
SSVEPLFGLP QPFFEPSPRR CRHGSKDDFL DDFPADMFDQ VDPIRSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281111524126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4694681e-151AF469468.1 Arabidopsis thaliana putative transcription factor (MYB125) mRNA, complete cds.
GenBankHM7765211e-151HM776521.1 Arabidopsis thaliana duo pollen 1 (DUO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402579.11e-155hypothetical protein EUTSA_v10006475mg
TrEMBLA0A087GZE90.0A0A087GZE9_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.5__2511__AT3G60460.11e-153(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-137MYB family protein